Lineage for d6k63a2 (6k63 A:151-294)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2525733Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2525734Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2525735Family c.97.1.1: Cytidine deaminase [53928] (4 proteins)
    strand 5 is antiparallel to strand 4
  6. 2525774Protein automated matches [190174] (3 species)
    not a true protein
  7. 2525797Species Klebsiella pneumoniae [TaxId:272620] [372319] (1 PDB entry)
  8. 2525799Domain d6k63a2: 6k63 A:151-294 [372424]
    automated match to d1alna2
    complexed with dio, zn

Details for d6k63a2

PDB Entry: 6k63 (more details), 2.07 Å

PDB Description: the crystal structure of cytidine deaminase from klebsiella pneumoniae
PDB Compounds: (A:) Cytidine deaminase

SCOPe Domain Sequences for d6k63a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k63a2 c.97.1.1 (A:151-294) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
greahalehylpdafgpkdleiktllmdeqdhgfpvsgdaltqaaiqaanrchapyshsp
sgvalelkdgtifsgsyaenaafnptlpplqgalnllslngydypaiqrailaekadaal
iqwdatvatlkalgchniervllg

SCOPe Domain Coordinates for d6k63a2:

Click to download the PDB-style file with coordinates for d6k63a2.
(The format of our PDB-style files is described here.)

Timeline for d6k63a2: