Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) contains extra C-terminal strand 5, order 21345 |
Family c.97.1.1: Cytidine deaminase [53928] (4 proteins) strand 5 is antiparallel to strand 4 |
Protein automated matches [190174] (3 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:272620] [372319] (1 PDB entry) |
Domain d6k63c2: 6k63 C:151-294 [372380] automated match to d1alna2 complexed with dio, zn |
PDB Entry: 6k63 (more details), 2.07 Å
SCOPe Domain Sequences for d6k63c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6k63c2 c.97.1.1 (C:151-294) automated matches {Klebsiella pneumoniae [TaxId: 272620]} greahalehylpdafgpkdleiktllmdeqdhgfpvsgdaltqaaiqaanrchapyshsp sgvalelkdgtifsgsyaenaafnptlpplqgalnllslngydypaiqrailaekadaal iqwdatvatlkalgchniervllg
Timeline for d6k63c2: