SCOPe 2.08: Domain d1eosb_: 1eos B:

Lineage for d1eosb_ (1eos B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (212 PDB entries)

8. Domain d1eosb_: 1eos B: [37238]
   complexed with u2g

Details for d1eosb_

PDB Entry: 1eos, 2 Å

PDB Description: crystal structure of ribonuclease a complexed with uridylyl(2',5')guanosine (productive binding)

PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d1eosb_:

Sequence; same for both SEQRES and ATOM records:

>d1eosb_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d1eosb_:

• d1eosb_ first appeared (with stable ids) in SCOP 1.55
  
• d1eosb_ appears in SCOPe 2.07