SCOPe 2.08: Domain d6o22d1: 6o22 D:2-164

Lineage for d6o22d1 (6o22 D:2-164)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.22: ASF1-like [101546] (2 families)
   contains extra C-terminal strand
   automatically mapped to Pfam PF04729

5. Family b.1.22.1: ASF1-like [101547] (2 proteins)

6. Protein automated matches [195145] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [347659] (6 PDB entries)

8. Domain d6o22d1: 6o22 D:2-164 [372370]
   Other proteins in same PDB: d6o22d2, d6o22f_
   automated match to d2cu9a1

Details for d6o22d1

PDB Entry: 6o22

PDB Description: structure of asf1-h3:h4-rtt109-vps75 histone chaperone-lysine acetyltransferase complex with the histone substrate.

PDB Compounds: (D:) histone chaperone asf1

SCOPe Domain Sequences for d6o22d1:

Sequence; same for both SEQRES and ATOM records:

>d6o22d1 b.1.22.1 (D:2-164) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsil
vgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydeee
lrenppakvqvdhivrnilaekprvtrfnivwdnenegdlypp

Timeline for d6o22d1:

• d6o22d1 first appeared in SCOPe 2.07