SCOP 1.71: Domain d1ssa.1: 1ssa A:,B:

Lineage for d1ssa.1 (1ssa A:,B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (1 family)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (125 PDB entries)

8. Domain d1ssa.1: 1ssa A:,B: [37236]
   complexed with so4

Details for d1ssa.1

PDB Entry: 1ssa, 2 Å

PDB Description: a structural investigation of catalytically modified f12ol and f12oy semisynthetic ribonucleases

SCOP Domain Sequences for d1ssa.1:

Sequence; same for both SEQRES and ATOM records:

>g1ssa.1 d.5.1.1 (A:,B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnXpyvpvh
ldasv

Timeline for d1ssa.1:

• d1ssa.1 first appeared (with stable ids) in SCOP 1.55
  
• d1ssa.1 appears in SCOP 1.69
  
• d1ssa.1 appears in SCOP 1.73
  
• d1ssa.1 appears in the current release, SCOPe 2.08