Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein c-KIT receptor [103296] (1 species) PTK group; PDGFR/VEGFR subfamily; membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [103297] (18 PDB entries) Uniprot P10721 547-935 |
Domain d6moba_: 6mob A: [372333] automated match to d1t46a_ complexed with jwy, no3 |
PDB Entry: 6mob (more details), 1.8 Å
SCOPe Domain Sequences for d6moba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6moba_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} nyvyidptqlpydhkwefprnrlsfgktlgagafgkvveataygliksdaamtvavkmlk psahlterealmselkvlsylgnhmnivnllgactiggptlviteyccygdllnflrrkr dsficsktspaimeddelaldledllsfsyqvakgmaflaskncihrdlaarnillthgr itkicdfglardikndsnyvvkgnarlpvkwmapesifncvytfesdvwsygiflwelfs lgsspypgmpvdskfykmikegfrmlspehapaemydimktcwdadplkrptfkqivqli ekqise
Timeline for d6moba_: