SCOP 1.73: Domain d1rbca_: 1rbc A:

Lineage for d1rbca_ (1rbc A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (1 family)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (142 PDB entries)

8. Domain d1rbca_: 1rbc A: [37232]
   complexed with nh2, so4; mutant

Details for d1rbca_

PDB Entry: 1rbc, 2 Å

PDB Description: crystallographic structures of ribonuclease s variants with nonpolar substitution at position 13: packing and cavities

PDB Compounds: (A:) ribonuclease s (s-protein)

SCOP Domain Sequences for d1rbca_:

Sequence; same for both SEQRES and ATOM records:

>d1rbca_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
sssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystms
itdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

Timeline for d1rbca_:

• d1rbca_ first appeared (with stable ids) in SCOP 1.55, called d1rbc__
  
• d1rbca_ was called d1rbc__ in SCOP 1.71
  
• d1rbca_ appears in SCOP 1.75
  
• d1rbca_ appears in the current release, SCOPe 2.08, called d1rbc.1