![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
![]() | Superfamily d.5.1: RNase A-like [54076] (1 family) ![]() can be classified as disulfide-rich |
![]() | Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) |
![]() | Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [54079] (142 PDB entries) |
![]() | Domain d1rbca_: 1rbc A: [37232] complexed with nh2, so4; mutant |
PDB Entry: 1rbc (more details), 2 Å
SCOP Domain Sequences for d1rbca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rbca_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]} sssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystms itdcretgsskypncaykttqankhiivacegnpyvpvhfdasv
Timeline for d1rbca_: