SCOP 1.71: Domain d1rbc__: 1rbc -

Lineage for d1rbc__ (1rbc -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (1 family)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (125 PDB entries)

8. Domain d1rbc__: 1rbc - [37232]
   complexed with nh2, so4; mutant

Details for d1rbc__

PDB Entry: 1rbc, 2 Å

PDB Description: crystallographic structures of ribonuclease s variants with nonpolar substitution at position 13: packing and cavities

SCOP Domain Sequences for d1rbc__:

Sequence; same for both SEQRES and ATOM records:

>d1rbc__ d.5.1.1 (-) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
sssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystms
itdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

Timeline for d1rbc__:

• d1rbc__ first appeared (with stable ids) in SCOP 1.55
  
• d1rbc__ appears in SCOP 1.69
  
• d1rbc__ is called d1rbca_ in SCOP 1.73
  
• d1rbc__ appears in the current release, SCOPe 2.08, called d1rbc.1