Lineage for d1rbc__ (1rbc -)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) Fold d.5: RNase A-like [54075] (1 superfamily) Superfamily d.5.1: RNase A-like [54076] (1 family) 
Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species) Species Cow (Bos taurus) [TaxId:9913] [54079] (115 PDB entries) 
Domain d1rbc__: 1rbc - [37232]
Details for d1rbc__
PDB Entry: 1rbc (more details), 2 Å
PDB Description: crystallographic structures of ribonuclease s variants with nonpolar substitution at position 13: packing and cavities
SCOP Domain Sequences for d1rbc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rbc__ d.5.1.1 (-) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
sssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystms
itdcretgsskypncaykttqankhiivacegnpyvpvhfdasv
SCOP Domain Coordinates for d1rbc__:
Click to download the PDB-style file with coordinates for d1rbc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rbc__:
- d1rbc__ first appeared (with stable ids) in SCOP 1.55
- d1rbc__ appears in SCOP 1.59
- d1rbc__ appears in SCOP 1.63
- d1rbc__ appears in the current release, SCOPe 2.08, called d1rbc.1
View in 3D