SCOPe 2.08: Domain d1rbc.1: 1rbc S:,A:

Lineage for d1rbc.1 (1rbc S:,A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (212 PDB entries)

8. Domain d1rbc.1: 1rbc S:,A: [37232]
   complexed with so4

Details for d1rbc.1

PDB Entry: 1rbc, 2 Å

PDB Description: crystallographic structures of ribonuclease s variants with nonpolar substitution at position 13: packing and cavities

PDB Compounds: (A:) ribonuclease s (s-protein), (S:) ribonuclease s (s-peptide)

SCOPe Domain Sequences for d1rbc.1:

Sequence; same for both SEQRES and ATOM records:

>g1rbc.1 d.5.1.1 (S:,A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhadsXsssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknva
ckngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

Timeline for d1rbc.1:

• d1rbc.1 first appeared (with stable ids) in SCOP 1.55, called d1rbc__
  
• d1rbc.1 appears in SCOPe 2.07