Lineage for d6hgsa_ (6hgs A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891304Protein Adenine PRTase [53288] (5 species)
  7. 2891316Species Human (Homo sapiens) [TaxId:9606] [102536] (16 PDB entries)
  8. 2891329Domain d6hgsa_: 6hgs A: [372307]
    automated match to d1zn8b_
    complexed with 5gp

Details for d6hgsa_

PDB Entry: 6hgs (more details), 1.55 Å

PDB Description: crystal structure of human aprt wild type in complex with gmp
PDB Compounds: (A:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d6hgsa_:

Sequence, based on SEQRES records: (download)

>d6hgsa_ c.61.1.1 (A:) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]}
dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia
gldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgqr
vvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye

Sequence, based on observed residues (ATOM records): (download)

>d6hgsa_ c.61.1.1 (A:) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]}
dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia
gldsrgflfgpslaqelglgcvlirkrgklpgptlwasyslgkaeleiqkdalepgqrvv
vvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye

SCOPe Domain Coordinates for d6hgsa_:

Click to download the PDB-style file with coordinates for d6hgsa_.
(The format of our PDB-style files is described here.)

Timeline for d6hgsa_: