![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.42: FUR-like [101027] (2 proteins) contains extra N-terminal helix and an alpha+beta dimerisation subdomain automatically mapped to Pfam PF01475 |
![]() | Protein automated matches [372268] (1 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:208964] [372269] (1 PDB entry) |
![]() | Domain d6h1ca_: 6h1c A: [372306] automated match to d1mzba_ complexed with mn, zn |
PDB Entry: 6h1c (more details), 2.34 Å
SCOPe Domain Sequences for d6h1ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h1ca_ a.4.5.42 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} mvenselrkaglkvtlprvkilqmldsaeqrhmsaedvykalmeagedvglatvyrvltq feaaglvvrhnfdgghavfeladsgahdhmvcvdtgeviefmdaeiekrqkeivrergfe lvdanlvlyvrk
Timeline for d6h1ca_: