Lineage for d6h1ca_ (6h1c A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694101Family a.4.5.42: FUR-like [101027] (2 proteins)
    contains extra N-terminal helix and an alpha+beta dimerisation subdomain
    automatically mapped to Pfam PF01475
  6. 2694105Protein automated matches [372268] (1 species)
    not a true protein
  7. 2694106Species Pseudomonas aeruginosa [TaxId:208964] [372269] (1 PDB entry)
  8. 2694107Domain d6h1ca_: 6h1c A: [372306]
    automated match to d1mzba_
    complexed with mn, zn

Details for d6h1ca_

PDB Entry: 6h1c (more details), 2.34 Å

PDB Description: structure of ferric uptake regulator from pseudomonas aeruginosa with manganese.
PDB Compounds: (A:) ferric uptake regulation protein

SCOPe Domain Sequences for d6h1ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h1ca_ a.4.5.42 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mvenselrkaglkvtlprvkilqmldsaeqrhmsaedvykalmeagedvglatvyrvltq
feaaglvvrhnfdgghavfeladsgahdhmvcvdtgeviefmdaeiekrqkeivrergfe
lvdanlvlyvrk

SCOPe Domain Coordinates for d6h1ca_:

Click to download the PDB-style file with coordinates for d6h1ca_.
(The format of our PDB-style files is described here.)

Timeline for d6h1ca_: