Lineage for d6hgqa_ (6hgq A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. Protein Adenine PRTase [53288] (5 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [102536] (16 PDB entries)
  8. Domain d6hgqa_: 6hgq A: [372305]
    automated match to d1zn8b_
    complexed with gol, hpa, mg, prp

Details for d6hgqa_

PDB Entry: 6hgq (more details), 1.9 Å

PDB Description: crystal structure of human aprt wild type in complex with hypoxanthine, prpp and mg2+
PDB Compounds: (A:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d6hgqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hgqa_ c.61.1.1 (A:) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]}
adselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyi
agldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgq
rvvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye

SCOPe Domain Coordinates for d6hgqa_ are not available.

Timeline for d6hgqa_:

Domains from other chains:
(mouse over for more information)
d6hgqb_, d6hgqc_, d6hgqd_