SCOPe 2.08: Domain d6gj5a_: 6gj5 A:

Lineage for d6gj5a_ (6gj5 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d6gj5a_: 6gj5 A: [372301]
   Other proteins in same PDB: d6gj5b2
   automated match to d5us4a_
   complexed with f0n, gcp, mg

Details for d6gj5a_

PDB Entry: 6gj5, 1.5 Å

PDB Description: crystal structure of kras g12d (gppcp) in complex with 15

PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d6gj5a_:

Sequence, based on SEQRES records:

>d6gj5a_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

Sequence, based on observed residues (ATOM records):

>d6gj5a_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlpsrt
vdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

Timeline for d6gj5a_:

• d6gj5a_ first appeared in SCOPe 2.07