SCOPe 2.05: Domain d1ssc.1: 1ssc A:,B:

Lineage for d1ssc.1 (1ssc A:,B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (177 PDB entries)

8. Domain d1ssc.1: 1ssc A:,B: [37230]
   semisynthetic
   complexed with po4

Details for d1ssc.1

PDB Entry: 1ssc, 2 Å

PDB Description: the 1.6 angstroms structure of a semisynthetic ribonuclease crystallized from aqueous ethanol. comparison with crystals from salt solutions and with rnase a from aqueous alcohol solutions

PDB Compounds: (A:) ribonuclease a, (B:) ribonuclease a

SCOPe Domain Sequences for d1ssc.1:

Sequence; same for both SEQRES and ATOM records:

>g1ssc.1 d.5.1.1 (A:,B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegXpyvpvhf
dasv

Timeline for d1ssc.1:

• d1ssc.1 first appeared (with stable ids) in SCOP 1.55
  
• d1ssc.1 appears in SCOPe 2.04
  
• d1ssc.1 appears in SCOPe 2.06
  
• d1ssc.1 appears in the current release, SCOPe 2.08