SCOPe 2.07: Domain d6h2va1: 6h2v A:2-209

Lineage for d6h2va1 (6h2v A:2-209)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (81 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187871] (32 PDB entries)

8. Domain d6h2va1: 6h2v A:2-209 [372282]
   Other proteins in same PDB: d6h2va2, d6h2vc2
   automated match to d1wy7c_
   protein/RNA complex; complexed with edo, peg, pg0, sam, so4

Details for d6h2va1

PDB Entry: 6h2v, 2.49 Å

PDB Description: crystal structure of human mettl5-trmt112 complex, the 18s rrna m6a1832 methyltransferase at 2.5a resolution

PDB Compounds: (A:) Methyltransferase-like protein 5

SCOPe Domain Sequences for d6h2va1:

Sequence; same for both SEQRES and ATOM records:

>d6h2va1 c.66.1.0 (A:2-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkvrlkelesrlqqvdgfekpkllleqyptrphiaacmlytihntyddienkvvadlgcg
cgvlsigtamlgaglcvgfdidedaleifnrnaeefeltnidmvqcdvcllsnrmsksfd
tvimnppfgtknnkgtdmaflktalemartavyslhksstrehvqkkaaewkikidiiae
lrydlpasykfhkkksvdievdlirfsf

Timeline for d6h2va1:

• d6h2va1 is new in SCOPe 2.07-stable
  
• d6h2va1 appears in the current release, SCOPe 2.08