Lineage for d6h2va1 (6h2v A:2-209)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (86 species)
    not a true protein
  7. 2894679Species Human (Homo sapiens) [TaxId:9606] [187871] (35 PDB entries)
  8. 2894765Domain d6h2va1: 6h2v A:2-209 [372282]
    Other proteins in same PDB: d6h2va2, d6h2vc2
    automated match to d1wy7c_
    protein/RNA complex; complexed with edo, peg, pg0, sam, so4

Details for d6h2va1

PDB Entry: 6h2v (more details), 2.49 Å

PDB Description: crystal structure of human mettl5-trmt112 complex, the 18s rrna m6a1832 methyltransferase at 2.5a resolution
PDB Compounds: (A:) Methyltransferase-like protein 5

SCOPe Domain Sequences for d6h2va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h2va1 c.66.1.0 (A:2-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkvrlkelesrlqqvdgfekpkllleqyptrphiaacmlytihntyddienkvvadlgcg
cgvlsigtamlgaglcvgfdidedaleifnrnaeefeltnidmvqcdvcllsnrmsksfd
tvimnppfgtknnkgtdmaflktalemartavyslhksstrehvqkkaaewkikidiiae
lrydlpasykfhkkksvdievdlirfsf

SCOPe Domain Coordinates for d6h2va1:

Click to download the PDB-style file with coordinates for d6h2va1.
(The format of our PDB-style files is described here.)

Timeline for d6h2va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6h2va2