Lineage for d5rsa__ (5rsa -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) Fold d.5: RNase A-like [54075] (1 superfamily) Superfamily d.5.1: RNase A-like [54076] (1 family) 
Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species) Species Cow (Bos taurus) [TaxId:9913] [54079] (93 PDB entries) 
Domain d5rsa__: 5rsa - [37228]
Details for d5rsa__
PDB Entry: 5rsa (more details), 2 Å
PDB Description: comparison of two independently refined models of ribonuclease-a
SCOP Domain Sequences for d5rsa__:
Sequence; same for both SEQRES and ATOM records: (download)
>d5rsa__ d.5.1.1 (-) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv
SCOP Domain Coordinates for d5rsa__:
Click to download the PDB-style file with coordinates for d5rsa__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5rsa__:
- d5rsa__ appears in SCOP 1.57
- d5rsa__ appears in the current release, SCOPe 2.08, called d5rsaa_
View in 3D