Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein automated matches [190095] (28 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [195677] (7 PDB entries) |
Domain d6h2rd_: 6h2r D: [372266] automated match to d1w3ia_ complexed with edo, gol, ipa, pge |
PDB Entry: 6h2r (more details), 1.57 Å
SCOPe Domain Sequences for d6h2rd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h2rd_ c.1.10.1 (D:) automated matches {Sulfolobus solfataricus [TaxId: 2287]} peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce vsphpvylynyptatgkdidakvakeigcftgvkdvieniihtldykrlnpnmlvysgsq mliatvastgldgnvalgsnylpevtvtikklamerkidealklqflhdevieasrifgs lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
Timeline for d6h2rd_: