Lineage for d6h2rb_ (6h2r B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834988Protein automated matches [190095] (28 species)
    not a true protein
  7. 2835262Species Sulfolobus solfataricus [TaxId:2287] [195677] (7 PDB entries)
  8. 2835266Domain d6h2rb_: 6h2r B: [372264]
    automated match to d1w3ia_
    complexed with edo, gol, ipa, pge

Details for d6h2rb_

PDB Entry: 6h2r (more details), 1.57 Å

PDB Description: sulfolobus solfataricus 2-keto-3-deoxygluconate aldolase t157v/d181q/a198l variant
PDB Compounds: (B:) 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase

SCOPe Domain Sequences for d6h2rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h2rb_ c.1.10.1 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
vsphpvylynyptatgkdidakvakeigcftgvkdvieniihtldykrlnpnmlvysgsq
mliatvastgldgnvalgsnylpevtvtikklamerkidealklqflhdevieasrifgs
lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilk

SCOPe Domain Coordinates for d6h2rb_:

Click to download the PDB-style file with coordinates for d6h2rb_.
(The format of our PDB-style files is described here.)

Timeline for d6h2rb_: