SCOP 1.55: Domain d1rbf__: 1rbf -

Lineage for d1rbf__ (1rbf -)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)

4. Superfamily d.5.1: RNase A-like [54076] (1 family)

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (93 PDB entries)

8. Domain d1rbf__: 1rbf - [37226]

Details for d1rbf__

PDB Entry: 1rbf, 1.8 Å

PDB Description: crystallographic structures of ribonuclease s variants with nonpolar substitution at position 13: packing and cavities

SCOP Domain Sequences for d1rbf__:

Sequence; same for both SEQRES and ATOM records:

>d1rbf__ d.5.1.1 (-) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
sssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystms
itdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

Timeline for d1rbf__:

• d1rbf__ appears in SCOP 1.57
  
• d1rbf__ appears in the current release, SCOPe 2.08, called d1rbf.1