Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein Adenine PRTase [53288] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [102536] (16 PDB entries) |
Domain d6hgpb_: 6hgp B: [372258] automated match to d1zn8b_ complexed with po4 |
PDB Entry: 6hgp (more details), 1.7 Å
SCOPe Domain Sequences for d6hgpb_:
Sequence, based on SEQRES records: (download)
>d6hgpb_ c.61.1.1 (B:) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia gldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgqr vvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye
>d6hgpb_ c.61.1.1 (B:) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia gldsrgflfgpslaqelglgcvlirkrgklpgptlwasyaeleiqkdalepgqrvvvvdd llatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye
Timeline for d6hgpb_: