Lineage for d6hgrb_ (6hgr B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. Protein Adenine PRTase [53288] (5 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [102536] (16 PDB entries)
  8. Domain d6hgrb_: 6hgr B: [372252]
    automated match to d1zn8b_
    complexed with imp

Details for d6hgrb_

PDB Entry: 6hgr (more details), 1.52 Å

PDB Description: crystal structure of human aprt wild type in complex with imp
PDB Compounds: (B:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d6hgrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hgrb_ c.61.1.1 (B:) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]}
dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia
gldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgqr
vvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye

SCOPe Domain Coordinates for d6hgrb_ are not available.

Timeline for d6hgrb_:

Domains from other chains:
(mouse over for more information)
d6hgra_