Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) Pfam PF13853. Phylogeny described in PubMed 12761335 |
Family f.13.1.0: automated matches [227143] (1 protein) not a true family |
Protein automated matches [226845] (25 species) not a true protein |
Species Nonlabens marinus [TaxId:1454201] [319523] (32 PDB entries) |
Domain d6ab9a_: 6ab9 A: [372238] automated match to d5g28a_ complexed with cl, ola, ret |
PDB Entry: 6ab9 (more details), 1.75 Å
SCOPe Domain Sequences for d6ab9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ab9a_ f.13.1.0 (A:) automated matches {Nonlabens marinus [TaxId: 1454201]} knieslfdysagqfefidhlltmgvgvhfaalifflvvsqfvapkyriatalscivmvsa glilnsqavmwtdayayvdgsyqlqdltfsngyryvnwmatipclllqllivlnlkgkel fstatwlilaawgmiitgyvgqlyevddiaqlmiwgavstaffvvmnwivgtkifknrat mlggtdstitkvfwlmmfawtlypiaylvpafmnnadgvvlrqllftiadisskviyglm ityiaiqqsaaagyvpaqqalgri
Timeline for d6ab9a_: