Lineage for d6ab9a_ (6ab9 A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022990Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 3022991Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 3023317Family f.13.1.0: automated matches [227143] (1 protein)
    not a true family
  6. 3023318Protein automated matches [226845] (25 species)
    not a true protein
  7. 3023539Species Nonlabens marinus [TaxId:1454201] [319523] (32 PDB entries)
  8. 3023549Domain d6ab9a_: 6ab9 A: [372238]
    automated match to d5g28a_
    complexed with cl, ola, ret

Details for d6ab9a_

PDB Entry: 6ab9 (more details), 1.75 Å

PDB Description: the crystal structure of the relaxed state of nonlabens marinus rhodopsin 3
PDB Compounds: (A:) Chloride pumping rhodopsin

SCOPe Domain Sequences for d6ab9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ab9a_ f.13.1.0 (A:) automated matches {Nonlabens marinus [TaxId: 1454201]}
knieslfdysagqfefidhlltmgvgvhfaalifflvvsqfvapkyriatalscivmvsa
glilnsqavmwtdayayvdgsyqlqdltfsngyryvnwmatipclllqllivlnlkgkel
fstatwlilaawgmiitgyvgqlyevddiaqlmiwgavstaffvvmnwivgtkifknrat
mlggtdstitkvfwlmmfawtlypiaylvpafmnnadgvvlrqllftiadisskviyglm
ityiaiqqsaaagyvpaqqalgri

SCOPe Domain Coordinates for d6ab9a_:

Click to download the PDB-style file with coordinates for d6ab9a_.
(The format of our PDB-style files is described here.)

Timeline for d6ab9a_: