Lineage for d6dtwa2 (6dtw A:430-550)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2462855Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2464026Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2464027Protein automated matches [190396] (40 species)
    not a true protein
  7. 2464182Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11678] [261468] (27 PDB entries)
  8. 3072154Domain d6dtwa2: 6dtw A:430-550 [372216]
    Other proteins in same PDB: d6dtwa1, d6dtwa3, d6dtwb_
    automated match to d1dloa1
    complexed with h9y, mg, so4; mutant

Details for d6dtwa2

PDB Entry: 6dtw (more details), 2.74 Å

PDB Description: hiv-1 reverse transcriptase y181c mutant in complex with jlj 578
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d6dtwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dtwa2 c.55.3.0 (A:430-550) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
k

SCOPe Domain Coordinates for d6dtwa2:

Click to download the PDB-style file with coordinates for d6dtwa2.
(The format of our PDB-style files is described here.)

Timeline for d6dtwa2:

  • d6dtwa2 is new in SCOPe 2.07-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d6dtwb_