Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) |
Superfamily d.5.1: RNase A-like [54076] (1 family) |
Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) |
Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [54079] (93 PDB entries) |
Domain d1xptb_: 1xpt B: [37220] |
PDB Entry: 1xpt (more details), 1.9 Å
SCOP Domain Sequences for d1xptb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xptb_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)} ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf dasv
Timeline for d1xptb_: