Lineage for d1xptb_ (1xpt B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) Fold d.5: RNase A-like [54075] (1 superfamily) Superfamily d.5.1: RNase A-like [54076] (1 family) 
Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species) Species Cow (Bos taurus) [TaxId:9913] [54079] (93 PDB entries) 
Domain d1xptb_: 1xpt B: [37220]
Details for d1xptb_
PDB Entry: 1xpt (more details), 1.9 Å
PDB Description: bovine ribonuclease a (phosphate-free)
SCOP Domain Sequences for d1xptb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xptb_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv
SCOP Domain Coordinates for d1xptb_:
Click to download the PDB-style file with coordinates for d1xptb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xptb_:
- d1xptb_ appears in SCOP 1.57
- d1xptb_ appears in the current release, SCOPe 2.08
View in 3D
