Lineage for d2rln.1 (2rln S:,E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928145Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)
  7. 2928150Species Cow (Bos taurus) [TaxId:9913] [54079] (212 PDB entries)
  8. 2928362Domain d2rln.1: 2rln S:,E: [37217]
    complexed with so4; mutant

Details for d2rln.1

PDB Entry: 2rln (more details), 1.85 Å

PDB Description: thermodynamic and structural consequences of changing a sulphur atom to a methylene group in the m13nle mutation in ribonuclease s
PDB Compounds: (E:) ribonuclease s (s-protein), (S:) Ribonuclease

SCOPe Domain Sequences for d2rln.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g2rln.1 d.5.1.1 (S:,E:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhldsXsssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknva
ckngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

SCOPe Domain Coordinates for d2rln.1:

Click to download the PDB-style file with coordinates for d2rln.1.
(The format of our PDB-style files is described here.)

Timeline for d2rln.1: