Lineage for d5zjeh1 (5zje H:1-159)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2452663Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2452702Protein Lactate dehydrogenase [51859] (19 species)
  7. 2452768Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (38 PDB entries)
  8. 2452966Domain d5zjeh1: 5zje H:1-159 [372143]
    Other proteins in same PDB: d5zjea2, d5zjeb2, d5zjec2, d5zjed2, d5zjee2, d5zjef2, d5zjeg2, d5zjeh2, d5zjei2, d5zjej2, d5zjek2, d5zjel2
    automated match to d4jnka1
    complexed with mli

Details for d5zjeh1

PDB Entry: 5zje (more details), 2.93 Å

PDB Description: ldha-mla
PDB Compounds: (H:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5zjeh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zjeh1 c.2.1.5 (H:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d5zjeh1:

Click to download the PDB-style file with coordinates for d5zjeh1.
(The format of our PDB-style files is described here.)

Timeline for d5zjeh1: