Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [54079] (177 PDB entries) |
Domain d1rbg.1: 1rbg S:,A: [37214] complexed with so4 |
PDB Entry: 1rbg (more details), 1.8 Å
SCOPe Domain Sequences for d1rbg.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1rbg.1 d.5.1.1 (S:,A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]} ketaaakferqhidsXsssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknva ckngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv
Timeline for d1rbg.1: