Class a: All alpha proteins [46456] (290 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) |
Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
Protein automated matches [190983] (12 species) not a true protein |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [234760] (22 PDB entries) |
Domain d6rgkb_: 6rgk B: [372120] automated match to d4i15a_ complexed with fmt, gai, gol, k3n, mg, zn |
PDB Entry: 6rgk (more details), 2.03 Å
SCOPe Domain Sequences for d6rgkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rgkb_ a.211.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} vtaitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkf gcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllit alvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgle gaertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisn vtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapf fqkivdaclqgmqwtvdriksnraqwervlet
Timeline for d6rgkb_: