Lineage for d6q3se2 (6q3s E:114-242)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352270Protein T-cell antigen receptor [49125] (7 species)
  7. 2352313Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (30 PDB entries)
  8. 3072053Domain d6q3se2: 6q3s E:114-242 [372115]
    Other proteins in same PDB: d6q3sa1, d6q3sa2, d6q3sb1, d6q3sb2, d6q3sd1, d6q3sd2, d6q3se1
    automated match to d2bnqe2
    complexed with act, gol

Details for d6q3se2

PDB Entry: 6q3s (more details), 2.5 Å

PDB Description: engineered human hla_a2 mhc class i molecule in complex with tcr and sv9 peptide
PDB Compounds: (E:) T cell receptor beta variable 6-5,Human nkt tcr beta chain

SCOPe Domain Sequences for d6q3se2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q3se2 b.1.1.2 (E:114-242) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d6q3se2:

Click to download the PDB-style file with coordinates for d6q3se2.
(The format of our PDB-style files is described here.)

Timeline for d6q3se2:

  • d6q3se2 appears in periodic updates to SCOPe 2.07 starting on 2019-07-26