SCOPe 2.08: Domain d6q3sd1: 6q3s D:2-115

Lineage for d6q3sd1 (6q3s D:2-115)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d6q3sd1: 6q3s D:2-115 [372104]
   Other proteins in same PDB: d6q3sa1, d6q3sa2, d6q3sb1, d6q3sb2, d6q3sd2, d6q3se1, d6q3se2
   automated match to d2f54d1
   complexed with act, gol

Details for d6q3sd1

PDB Entry: 6q3s, 2.5 Å

PDB Description: engineered human hla_a2 mhc class i molecule in complex with tcr and sv9 peptide

PDB Compounds: (D:) T cell receptor alpha variable 21,T-cell receptor, sp3.4 alpha chain

SCOPe Domain Sequences for d6q3sd1:

Sequence; same for both SEQRES and ATOM records:

>d6q3sd1 b.1.1.1 (D:2-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qevtqipaalsvpegenlvlncsftdsaiynlqwfrqdpgkgltsllliqssqreqtsgr
lnasldkssgrstlyiaasqpgdsatylcavrptsggsyiptfgrgtslivhpy

Timeline for d6q3sd1:

• d6q3sd1 first appeared in SCOPe 2.07