SCOPe 2.07: Domain d6qkdt2: 6qkd T:107-212

Lineage for d6qkdt2 (6qkd T:107-212)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Llama (Lama glama) [TaxId:9844] [317148] (4 PDB entries)
Domain d6qkdt2: 6qkd T:107-212 [372097]
Other proteins in same PDB: d6qkdl1, d6qkdm1, d6qkdo1, d6qkdt1
automated match to d1dn0a2
complexed with cl, so4

Details for d6qkdt2

PDB Entry: 6qkd (more details), 1.9 Å

PDB Description: crystal structure of vhh-based fab-fragment of antibody bcd-085

PDB Compounds: (T:) Fab light chain

SCOPe Domain Sequences for d6qkdt2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qkdt2 b.1.1.2 (T:107-212) automated matches {Llama (Lama glama) [TaxId: 9844]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d6qkdt2:

Click to download the PDB-style file with coordinates for d6qkdt2.
(The format of our PDB-style files is described here.)

Timeline for d6qkdt2: