Lineage for d1afla_ (1afl A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77162Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 77163Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 77164Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 77208Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 77209Species Cow (Bos taurus) [TaxId:9913] [54079] (99 PDB entries)
  8. 77253Domain d1afla_: 1afl A: [37208]

Details for d1afla_

PDB Entry: 1afl (more details), 1.7 Å

PDB Description: ribonuclease a in complex with 5'-diphosphoadenosine 2'-phosphate at 1.7 angstrom resolution

SCOP Domain Sequences for d1afla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afla_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOP Domain Coordinates for d1afla_:

Click to download the PDB-style file with coordinates for d1afla_.
(The format of our PDB-style files is described here.)

Timeline for d1afla_: