SCOPe 2.08: Domain d1afla_: 1afl A:

Lineage for d1afla_ (1afl A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (212 PDB entries)

8. Domain d1afla_: 1afl A: [37208]
   complexed with atr, cit

Details for d1afla_

PDB Entry: 1afl, 1.7 Å

PDB Description: ribonuclease a in complex with 5'-diphosphoadenosine 2'-phosphate at 1.7 angstrom resolution

PDB Compounds: (A:) ribonuclease a

SCOPe Domain Sequences for d1afla_:

Sequence; same for both SEQRES and ATOM records:

>d1afla_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d1afla_:

• d1afla_ first appeared (with stable ids) in SCOP 1.55
  
• d1afla_ appears in SCOPe 2.07