SCOPe 2.07: Domain d1rnwa_: 1rnw A:

Lineage for d1rnwa_ (1rnw A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (210 PDB entries)

8. Domain d1rnwa_: 1rnw A: [37207]
   complexed with so4

Details for d1rnwa_

PDB Entry: 1rnw, 1.8 Å

PDB Description: recombinant ribonuclease a crystallized from 80% ammonium sulphate

PDB Compounds: (A:) ribonuclease a

SCOPe Domain Sequences for d1rnwa_:

Sequence; same for both SEQRES and ATOM records:

>d1rnwa_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d1rnwa_:

• d1rnwa_ first appeared (with stable ids) in SCOP 1.55, called d1rnw__
  
• d1rnwa_ appears in SCOPe 2.06
  
• d1rnwa_ appears in the current release, SCOPe 2.08