Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (34 species) not a true protein |
Species Candida albicans [TaxId:237561] [329047] (2 PDB entries) |
Domain d6ptab_: 6pta B: [372052] automated match to d3lrpa_ complexed with gdp |
PDB Entry: 6pta (more details), 2.5 Å
SCOPe Domain Sequences for d6ptab_:
Sequence, based on SEQRES records: (download)
>d6ptab_ c.37.1.8 (B:) automated matches {Candida albicans [TaxId: 237561]} lfasllgrremrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwd vggqdkirplwryyfqntqgiifvvdsndrdrineareelqsmlnedelkdavllvlank qdlpnamnaaeitekmglhsirnrpwfiqatcattgdglyeglewlsnqvgk
>d6ptab_ c.37.1.8 (B:) automated matches {Candida albicans [TaxId: 237561]} lfasllgemrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvg gplwryyfqntqgiifvvdsndrdrineareelqsmlnedelkdavllvlankqdlpnam naaeitekmglhsirnrpwfiqatcattgdglyeglewlsnqvgk
Timeline for d6ptab_: