SCOPe 2.07: Domain d6q3ka2: 6q3k A:182-274

Lineage for d6q3ka2 (6q3k A:182-274)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6q3ka2: 6q3k A:182-274 [372051]
   Other proteins in same PDB: d6q3ka1, d6q3kb1, d6q3kb2
   automated match to d1ogaa1
   complexed with co, gol

Details for d6q3ka2

PDB Entry: 6q3k, 1.5 Å

PDB Description: engineered human hla_a2 mhc class i molecule in complex with nv9 peptide

PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d6q3ka2:

Sequence; same for both SEQRES and ATOM records:

>d6q3ka2 b.1.1.0 (A:182-274) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwvavvvpsgqeqrytchvqheglpkpltlrw

Timeline for d6q3ka2:

• d6q3ka2 is new in SCOPe 2.07-stable
  
• d6q3ka2 appears in the current release, SCOPe 2.08