Lineage for d6q3ka1 (6q3k A:0-181)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2506505Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2506604Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2506616Species Human (Homo sapiens), HLA-A2 [TaxId:9606] [54469] (9 PDB entries)
  8. 3071988Domain d6q3ka1: 6q3k A:0-181 [372050]
    Other proteins in same PDB: d6q3ka2, d6q3kb1, d6q3kb2
    automated match to d4l29a1
    complexed with co, gol

Details for d6q3ka1

PDB Entry: 6q3k (more details), 1.5 Å

PDB Description: engineered human hla_a2 mhc class i molecule in complex with nv9 peptide
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d6q3ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q3ka1 d.19.1.1 (A:0-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2 [TaxId: 9606]}
agshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpey
wdgetrkvkahsqthrvdlgtlrgcynqseagshtvqrmygcdvgsdwrflrgyhqyayd
gkdyialkedlrswtaadmcaqttkhkweaahvaeqlraylegtcvewlrrylengketl
qr

SCOPe Domain Coordinates for d6q3ka1:

Click to download the PDB-style file with coordinates for d6q3ka1.
(The format of our PDB-style files is described here.)

Timeline for d6q3ka1:

  • d6q3ka1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6q3ka2