| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) ![]() contains a common phosphate-binding site |
| Family c.24.1.0: automated matches [347767] (1 protein) not a true family |
| Protein automated matches [347768] (3 species) not a true protein |
| Species Elizabethkingia anophelis [TaxId:1338011] [372032] (1 PDB entry) |
| Domain d6phej_: 6phe J: [372041] automated match to d1b93a_ complexed with mpd, po4 |
PDB Entry: 6phe (more details), 2.1 Å
SCOPe Domain Sequences for d6phej_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6phej_ c.24.1.0 (J:) automated matches {Elizabethkingia anophelis [TaxId: 1338011]}
sirtlperktialvahdhkkddlvrwvqkhagkltkhnliatgttgklieedlgvevkrv
msgplggdqqlgsmiaqrqidiviffwdpmeaqphdsdvkafirlcvvwntpmacdsata
dfilsspfmeteyqaeipdydgylkrnipea
Timeline for d6phej_: