SCOP 1.57: Domain d1xpsb_: 1xps B:

Lineage for d1xpsb_ (1xps B:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)

4. Superfamily d.5.1: RNase A-like [54076] (1 family)

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (99 PDB entries)

8. Domain d1xpsb_: 1xps B: [37203]

Details for d1xpsb_

PDB Entry: 1xps, 1.8 Å

PDB Description: bovine ribonuclease a (phosphate-free) (93 % humidity)

SCOP Domain Sequences for d1xpsb_:

Sequence; same for both SEQRES and ATOM records:

>d1xpsb_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d1xpsb_:

• d1xpsb_ first appeared (with stable ids) in SCOP 1.55
  
• d1xpsb_ appears in SCOP 1.59
  
• d1xpsb_ appears in the current release, SCOPe 2.08