Lineage for d6pbla2 (6pbl A:157-330)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2999522Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2999523Protein automated matches [226850] (47 species)
    not a true protein
  7. 2999684Species Legionella pneumophila [TaxId:272624] [372027] (1 PDB entry)
  8. 2999685Domain d6pbla2: 6pbl A:157-330 [372028]
    Other proteins in same PDB: d6pbla1, d6pblb1
    automated match to d4tvoa2

Details for d6pbla2

PDB Entry: 6pbl (more details), 1.85 Å

PDB Description: crystal structure of malate dehydrogenase from legionella pneumophila philadelphia 1
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d6pbla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pbla2 d.162.1.0 (A:157-330) automated matches {Legionella pneumophila [TaxId: 272624]}
ttldelrartqlakkagvditavtqmtiwgnhsatqypdfynakingtsaaqvindetwl
ketfvstvqqrgaavikargsssaasaanaiitgvnhlvtdtpagesfsmcrrskgeygv
deglifsfpcrrehgelkvvenlefndfgrerfnttlnelrserdtvkslglld

SCOPe Domain Coordinates for d6pbla2:

Click to download the PDB-style file with coordinates for d6pbla2.
(The format of our PDB-style files is described here.)

Timeline for d6pbla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6pbla1