![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
![]() | Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
![]() | Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
![]() | Protein automated matches [226850] (47 species) not a true protein |
![]() | Species Legionella pneumophila [TaxId:272624] [372027] (1 PDB entry) |
![]() | Domain d6pbla2: 6pbl A:157-330 [372028] Other proteins in same PDB: d6pbla1, d6pblb1 automated match to d4tvoa2 |
PDB Entry: 6pbl (more details), 1.85 Å
SCOPe Domain Sequences for d6pbla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pbla2 d.162.1.0 (A:157-330) automated matches {Legionella pneumophila [TaxId: 272624]} ttldelrartqlakkagvditavtqmtiwgnhsatqypdfynakingtsaaqvindetwl ketfvstvqqrgaavikargsssaasaanaiitgvnhlvtdtpagesfsmcrrskgeygv deglifsfpcrrehgelkvvenlefndfgrerfnttlnelrserdtvkslglld
Timeline for d6pbla2: