Lineage for d6ol7p_ (6ol7 P:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744927Domain d6ol7p_: 6ol7 P: [372009]
    Other proteins in same PDB: d6ol7b1, d6ol7b2, d6ol7c1, d6ol7c2, d6ol7d_, d6ol7f1, d6ol7f2, d6ol7h_, d6ol7i_, d6ol7j_, d6ol7l1, d6ol7l2, d6ol7m_, d6ol7n1, d6ol7n2, d6ol7o_, d6ol7q_
    automated match to d3ab0b_
    complexed with cl, edo, peg

Details for d6ol7p_

PDB Entry: 6ol7 (more details), 2.42 Å

PDB Description: crystal structure of glvrc01 scfv in complex with anti-idiotype iv8 scfv
PDB Compounds: (P:) iv8 Heavy Chain

SCOPe Domain Sequences for d6ol7p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ol7p_ b.1.1.1 (P:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evklvesggdfvkpggslklscaasgftfsnsamswvrqtpekrlewvatinnnggythy
pdtlkdrftisrdnvkntlylqmsslrsedtalyyctrqtywyldvwgagttvtvss

SCOPe Domain Coordinates for d6ol7p_:

Click to download the PDB-style file with coordinates for d6ol7p_.
(The format of our PDB-style files is described here.)

Timeline for d6ol7p_: