SCOPe 2.07: Domain d1afkb_: 1afk B:

Lineage for d1afkb_ (1afk B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (210 PDB entries)

8. Domain d1afkb_: 1afk B: [37200]
   complexed with pap

Details for d1afkb_

PDB Entry: 1afk, 1.7 Å

PDB Description: crystal structure of ribonuclease a in complex with 5'-diphosphoadenosine-3'-phosphate

PDB Compounds: (B:) ribonuclease a

SCOPe Domain Sequences for d1afkb_:

Sequence; same for both SEQRES and ATOM records:

>d1afkb_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d1afkb_:

• d1afkb_ first appeared (with stable ids) in SCOP 1.55
  
• d1afkb_ appears in SCOPe 2.06
  
• d1afkb_ appears in the current release, SCOPe 2.08