Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (61 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225691] (37 PDB entries) |
Domain d6o4hc1: 6o4h C:4-499 [371965] Other proteins in same PDB: d6o4ha2, d6o4hb2, d6o4hc2, d6o4hd2, d6o4he2, d6o4hf2, d6o4hg2, d6o4hh2 automated match to d2jg7a_ complexed with edo, nad; mutant |
PDB Entry: 6o4h (more details), 2.05 Å
SCOPe Domain Sequences for d6o4hc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6o4hc1 c.82.1.0 (C:4-499) automated matches {Human (Homo sapiens) [TaxId: 9606]} llinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyeet vkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqeyv dicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvvvygwnnaiamic gnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnlls ftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrct tarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakke ggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfawnnev kqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgsd awkqymrrstctinys
Timeline for d6o4hc1: