Lineage for d6o4hc1 (6o4h C:4-499)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2909231Species Human (Homo sapiens) [TaxId:9606] [225691] (37 PDB entries)
  8. 2909338Domain d6o4hc1: 6o4h C:4-499 [371965]
    Other proteins in same PDB: d6o4ha2, d6o4hb2, d6o4hc2, d6o4hd2, d6o4he2, d6o4hf2, d6o4hg2, d6o4hh2
    automated match to d2jg7a_
    complexed with edo, nad; mutant

Details for d6o4hc1

PDB Entry: 6o4h (more details), 2.05 Å

PDB Description: structure of aldh7a1 mutant a171v complexed with nad
PDB Compounds: (C:) Alpha-aminoadipic semialdehyde dehydrogenase

SCOPe Domain Sequences for d6o4hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o4hc1 c.82.1.0 (C:4-499) automated matches {Human (Homo sapiens) [TaxId: 9606]}
llinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyeet
vkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqeyv
dicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvvvygwnnaiamic
gnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnlls
ftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrct
tarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakke
ggtvvyggkvmdrpgnyveptivtglghdasiahtetfapilyvfkfkneeevfawnnev
kqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgsd
awkqymrrstctinys

SCOPe Domain Coordinates for d6o4hc1:

Click to download the PDB-style file with coordinates for d6o4hc1.
(The format of our PDB-style files is described here.)

Timeline for d6o4hc1: