SCOP 1.61: Domain d1rbh__: 1rbh -

Lineage for d1rbh__ (1rbh -)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)

4. Superfamily d.5.1: RNase A-like [54076] (1 family)

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (115 PDB entries)

8. Domain d1rbh__: 1rbh - [37195]

Details for d1rbh__

PDB Entry: 1rbh, 1.7 Å

PDB Description: crystallographic structures of ribonuclease s variants with nonpolar substitution at position 13: packing and cavities

SCOP Domain Sequences for d1rbh__:

Sequence; same for both SEQRES and ATOM records:

>d1rbh__ d.5.1.1 (-) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
sssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystms
itdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

Timeline for d1rbh__:

• d1rbh__ first appeared (with stable ids) in SCOP 1.55
  
• d1rbh__ appears in SCOP 1.59
  
• d1rbh__ appears in SCOP 1.63
  
• d1rbh__ appears in the current release, SCOPe 2.08, called d1rbh.1