Lineage for d1f0vd_ (1f0v D:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [54079] (210 PDB entries)
  8. Domain d1f0vd_: 1f0v D: [37193]
    a new type of 3d domain swapping
    protein/DNA complex; complexed with gol, po4

Details for d1f0vd_

PDB Entry: 1f0v (more details), 1.7 Å

PDB Description: Crystal structure of an Rnase A dimer displaying a new type of 3D domain swapping
PDB Compounds: (D:) ribonuclease a

SCOPe Domain Sequences for d1f0vd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f0vd_ d.5.1.1 (D:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d1f0vd_ are not available.

Timeline for d1f0vd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f0va_, d1f0vb_, d1f0vc_