Lineage for d1f0vc_ (1f0v C:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253232Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 253233Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulphide-rich
  5. 253234Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 253291Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 253292Species Cow (Bos taurus) [TaxId:9913] [54079] (115 PDB entries)
  8. 253331Domain d1f0vc_: 1f0v C: [37192]

Details for d1f0vc_

PDB Entry: 1f0v (more details), 1.7 Å

PDB Description: Crystal structure of an Rnase A dimer displaying a new type of 3D domain swapping

SCOP Domain Sequences for d1f0vc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f0vc_ d.5.1.1 (C:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOP Domain Coordinates for d1f0vc_:

Click to download the PDB-style file with coordinates for d1f0vc_.
(The format of our PDB-style files is described here.)

Timeline for d1f0vc_: