Lineage for d6mr4b_ (6mr4 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706929Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [371895] (3 PDB entries)
  8. 2706943Domain d6mr4b_: 6mr4 B: [371903]
    automated match to d3qzta_

Details for d6mr4b_

PDB Entry: 6mr4 (more details), 2.71 Å

PDB Description: crystal structure of the sth1 bromodomain from s.cerevisiae
PDB Compounds: (B:) Nuclear protein STH1/NPS1

SCOPe Domain Sequences for d6mr4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mr4b_ a.29.2.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ifptveklveemreqldevdshprtsifeklpskrdypdyfkviekpmaidiilknckng
tyktleevrqalqtmfenarfyneegswvyvdadklneftdewfke

SCOPe Domain Coordinates for d6mr4b_:

Click to download the PDB-style file with coordinates for d6mr4b_.
(The format of our PDB-style files is described here.)

Timeline for d6mr4b_: