Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (15 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [371895] (3 PDB entries) |
Domain d6mr4b_: 6mr4 B: [371903] automated match to d3qzta_ |
PDB Entry: 6mr4 (more details), 2.71 Å
SCOPe Domain Sequences for d6mr4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mr4b_ a.29.2.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ifptveklveemreqldevdshprtsifeklpskrdypdyfkviekpmaidiilknckng tyktleevrqalqtmfenarfyneegswvyvdadklneftdewfke
Timeline for d6mr4b_: